PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca3474.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NF-YB
Protein Properties Length: 129aa    MW: 12625.6 Da    PI: 7.0894
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca3474.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB57.53.3e-182358237
      NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqe 37
               +eqdrflPianvsrimkk+lPanakiskdaketvqe
  Dca3474.1 23 KEQDRFLPIANVSRIMKKALPANAKISKDAKETVQE 58
               79*********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.56E-11961IPR009072Histone-fold
Gene3DG3DSA:1.10.20.103.3E-162058IPR009072Histone-fold
PfamPF008088.8E-102861IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MADSDNDSGG RSHGGEHHLS SLKEQDRFLP IANVSRIMKK ALPANAKISK DAKETVQEEL  60
EGERTGNPIQ GNGGGGGGGS SGGVSSGGNG GGYGNGGGGS GGVNNGVMMM GHVIGQSGQG  120
YGGHGYGAK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-26nuclear factor Y, subunit B3